PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015893966.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 689aa    MW: 75775 Da    PI: 5.8179
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015893966.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS438.64.6e-1343276881374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv+lLl+cAeav+++d  la+++L +l+  ++p gd+mqR+aa+f+ AL+arl+  + ++    +++++ +++s e+l+++++ ++++P++kf+h
  XP_015893966.1 327 LVHLLLACAEAVAKEDYMLARRYLHHLNRVVTPIGDSMQRVAACFADALSARLTA-TLTTNPVTASTPSFPSSSLEVLKIYQIVYQACPYVKFAH 420
                     68****************************************************9.333333334444555669********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +taNqaI ea+e e+rvH+iD+di qG QWpa++qaLa+Rp g+p lRiTgvg+    s ++++etg+ L+++A++l+vpfef++ v ++ledl+
  XP_015893966.1 421 FTANQAIFEAFEAEDRVHVIDLDILQGYQWPAFMQALAARPTGAPFLRITGVGP----SIDKVRETGRCLTELAHSLHVPFEFHA-VGEELEDLK 510
                     ******************************************************....9**************************.7******** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     ++++  + gEalaVn+v +lhr++    +l     ++L ++++  P++v++veqea+hn++ Fl rfleal+yysa+fdsl+a++p++s +r+kv
  XP_015893966.1 511 PHMFYRRVGEALAVNSVNRLHRVP--GNCLG----NLLTMIRDQAPNIVTLVEQEASHNGPYFLGRFLEALHYYSAIFDSLDATFPPDSAQRAKV 599
                     ****9999***************9..44444....5*********************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     E+ ++++ei+n+vacegaer++rhe+lekWr+ +e  GFk v+ls +a++q k ll  ++ +gyr+ e++g+l+lgW+drpL+++SaWr
  XP_015893966.1 600 EQYIFAPEIRNIVACEGAERIQRHERLEKWRKVMEGKGFKGVALSANAVTQSKILLGLYSCEGYRLTEDKGCLLLGWQDRPLIAASAWR 688
                     ****************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.258301668IPR005202Transcription factor GRAS
PfamPF035141.6E-131327688IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MINSLCGSMS IKSESSCTNK IQPETSSNES NSISEPKKKF SSSQCSDIMD QQQSSLTPPS  60
LNFPTLKFDL DGDLEVQSPD NSSLWESLFS DQFDSDFMIL SPVRNLPSPR QTSNYNYNNN  120
YNYAQSMQGQ SLLGCSPPRF GSQVGAAFSS RGKGLSPLHR VFNSPNNNNG SSSNQYMQHT  180
DTFALQAIED FLDDYQRDGF VVGGFNKMTG MAGGGGNSSS EQSYDLPTPP TLDCLAIPNS  240
SSSSRFCGSA SETSSGPGGS QVTQEGGGYQ MGTIGPGAPL SEQLRQERRE DKQQSQPPVQ  300
LHHNLNHSLM APLPIASDQE QDSGLQLVHL LLACAEAVAK EDYMLARRYL HHLNRVVTPI  360
GDSMQRVAAC FADALSARLT ATLTTNPVTA STPSFPSSSL EVLKIYQIVY QACPYVKFAH  420
FTANQAIFEA FEAEDRVHVI DLDILQGYQW PAFMQALAAR PTGAPFLRIT GVGPSIDKVR  480
ETGRCLTELA HSLHVPFEFH AVGEELEDLK PHMFYRRVGE ALAVNSVNRL HRVPGNCLGN  540
LLTMIRDQAP NIVTLVEQEA SHNGPYFLGR FLEALHYYSA IFDSLDATFP PDSAQRAKVE  600
QYIFAPEIRN IVACEGAERI QRHERLEKWR KVMEGKGFKG VALSANAVTQ SKILLGLYSC  660
EGYRLTEDKG CLLLGWQDRP LIAASAWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-613276884375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015893966.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLB9GF630.0B9GF63_POPTR; Uncharacterized protein
STRINGPOPTR_0001s33360.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF94703243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-99RGA-like 1